Your Basket

0 item(s)

shipping-icon

Free delivery on tests

trustpilotTrusted by 100,000+ clients
Vital Protein is a range of pea protein isolates extracted from golden peas by a natural process to ensure maximum bio-availability. Protein is essential for the support of lean muscle mass, immune function, energy levels, weight control and is the basis for body maintenance.
Vital Health
See full range

Vital Protein (Pea Protein) Vanilla 1kg

Vital Protein is a range of pea protein isolates extracted from golden peas by a natural process to ensure maximum bio-availability. Protein is essential for the support of lean muscle mass, immune function, energy levels, weight control and is the basis for body maintenance.

Powder / Granules 1000 g

£47.95

1
american-expressapple-paygoogle-paymasterpaypalvisaklarnatrustpilot