Your Basket

0 item(s)

shipping-icon

Free delivery on tests

trustpilotTrusted by 100,000+ clients
Super Vitamin B Complex is an advanced and complete B-vitamin supplement. It provides substantial amounts of all eleven B-vitamins, including the co-enzyme forms of vitamins B2 and B6 for enhanced bioavailability and extra pantothenic acid.
Allergy Research
See full range

Super Vitamin B 120's

Super Vitamin B Complex is an advanced and complete B-vitamin supplement. It provides substantial amounts of all eleven B-vitamins, including the co-enzyme forms of vitamins B2 and B6 for enhanced bioavailability and extra pantothenic acid.

120 Capsules

£25.46

1
american-expressapple-paygoogle-paymasterpaypalvisaklarnatrustpilot