Your Basket

0 item(s)

shipping-icon

Free delivery on tests

trustpilotTrusted by 100,000+ clients
Source of Life Gold is the most comprehensive whole food multivitamin supplement available. With over 110 colourful fruits and vegetables, this unique formula provides all essential food extracted vitamins and minerals that are needed on a daily basis with a blend of enzyme-rich organic superfoods.
NaturesPlus
See full range

Source of Life GOLD Liquid 240ml

Source of Life Gold is the most comprehensive whole food multivitamin supplement available. With over 110 colourful fruits and vegetables, this unique formula provides all essential food extracted vitamins and minerals that are needed on a daily basis with a blend of enzyme-rich organic superfoods.

Liquid 240 ml

£17.50

1
american-expressapple-paygoogle-paymasterpaypalvisaklarnatrustpilot