Your Basket

0 item(s)

shipping-icon

Free delivery on tests

trustpilotTrusted by 100,000+ clients
100% hydrolysed and grass fed collagen powder made from the highest standard European bovine, produced in the Cotswolds. Contains 18 amino acids including glycine, proline and hydroxyproline. 9 grams of protein per serving. Gluten Free, Dairy Free, GMO Free, No preservatives. 0% sugar, 0% fat.
Feel Complete
See full range

Protein Collagen 300g

100% hydrolysed and grass fed collagen powder made from the highest standard European bovine, produced in the Cotswolds. Contains 18 amino acids including glycine, proline and hydroxyproline. 9 grams of protein per serving. Gluten Free, Dairy Free, GMO Free, No preservatives. 0% sugar, 0% fat.

Powder / Granules 300 g

£22.99

1
american-expressapple-paygoogle-paymasterpaypalvisaklarnatrustpilot