Your Basket

0 item(s)

shipping-icon

Free delivery on tests

trustpilotTrusted by 100,000+ clients
A complete blend of plant protein, BCAAs, turmeric and digestive enzymes. 25g protein and 6g BCAA per serving. Added turmeric extract to optimise recovery. 100% raw, plant-based ingredients. Fermented protein for optimal digestion.

Perform Plant Protein Banana & Cinnamon 988g

A complete blend of plant protein, BCAAs, turmeric and digestive enzymes. 25g protein and 6g BCAA per serving. Added turmeric extract to optimise recovery. 100% raw, plant-based ingredients. Fermented protein for optimal digestion.

Powder / Granules 988 g

£44.99

1
american-expressapple-paygoogle-paymasterpaypalvisaklarnatrustpilot