Your Basket

0 item(s)

shipping-icon

Free delivery on tests

trustpilotTrusted by 100,000+ clients
Magnesium is important for many processes in the body, including regulating muscle and nerve function, blood sugar levels, and blood pressure and making protein. Ocean Mag is a natural source of magnesium hydroxide, which can be conveniently added to water to help maintain magnesium levels.
One Nutrition
See full range

Ocean Mag Powder 100g

Magnesium is important for many processes in the body, including regulating muscle and nerve function, blood sugar levels, and blood pressure and making protein. Ocean Mag is a natural source of magnesium hydroxide, which can be conveniently added to water to help maintain magnesium levels.

Powder / Granules 100 g

£21.99

1
american-expressapple-paygoogle-paymasterpaypalvisaklarnatrustpilot