Your Basket

0 item(s)

shipping-icon

Free delivery on tests

trustpilotTrusted by 100,000+ clients
Isolated, purified and encapsulated nattokinase, an enzyme derived from boiled soybeans and a selected, patented strain of Bacillus subtilis natto.
Allergy Research
See full range

Nattokinase 50mg 90's

Isolated, purified and encapsulated nattokinase, an enzyme derived from boiled soybeans and a selected, patented strain of Bacillus subtilis natto.

90 Capsules

£61.96

1
american-expressapple-paygoogle-paymasterpaypalvisaklarnatrustpilot