Your Basket

0 item(s)

shipping-icon

Free delivery on tests

trustpilotTrusted by 100,000+ clients
One of the most nutrient-dense plants on earth - rich in iron, calcium and plant protein. Supports energy and balance with a mild, spinachy flavour.

Moringa Superfood Powder 275g

One of the most nutrient-dense plants on earth - rich in iron, calcium and plant protein. Supports energy and balance with a mild, spinachy flavour.

Powder / Granules 275 g

£14.99

1
american-expressapple-paygoogle-paymasterpaypalvisaklarnatrustpilot