Your Basket

0 item(s)

shipping-icon

Free delivery on tests

trustpilotTrusted by 100,000+ clients
This blend contains a high percentage of magnesium and selenium. It also contains co-enzyme Q10, an enzyme that occurs naturally in the body but declines with age, making dietary sources important in helping maintain adequate levels.

Milled Flaxseed, Almonds, Brazil Nuts, Walnuts & CoQ10 360g

This blend contains a high percentage of magnesium and selenium. It also contains co-enzyme Q10, an enzyme that occurs naturally in the body but declines with age, making dietary sources important in helping maintain adequate levels.

Powder / Granules 360 g

£6.99

1
american-expressapple-paygoogle-paymasterpaypalvisaklarnatrustpilot