Your Basket

0 item(s)

shipping-icon

Free delivery on tests

trustpilotTrusted by 100,000+ clients
Contains the essential amino acid L-Lysine hydrochloride. Lysine is naturally found in animal proteins and is needed for the production of carnitine, which helps the body metabolise fats. Vegans can be deficient in this. This formula is free from animal products.
Higher Nature
See full range

Lysine 90's

Contains the essential amino acid L-Lysine hydrochloride. Lysine is naturally found in animal proteins and is needed for the production of carnitine, which helps the body metabolise fats. Vegans can be deficient in this. This formula is free from animal products.

90 Tablets

£11.45

1
american-expressapple-paygoogle-paymasterpaypalvisaklarnatrustpilot