Your Basket

0 item(s)

shipping-icon

Free delivery on tests

trustpilotTrusted by 100,000+ clients
Leapfrog SNOOZE is the UK's 1st chewable supplement with Lactium®, Lactoferrin and Vitamin B6. Lactium® is a patented, all-natural, bio-active peptide derived from cow's milk that has soothing effects on the nervous system. Lactium® has been shown to increase GABA activity and reduce cortisol.
Leapfrog Remedies
See full range

Leapfrog SNOOZE 15's

Leapfrog SNOOZE is the UK's 1st chewable supplement with Lactium®, Lactoferrin and Vitamin B6. Lactium® is a patented, all-natural, bio-active peptide derived from cow's milk that has soothing effects on the nervous system. Lactium® has been shown to increase GABA activity and reduce cortisol.

15 Chewable tablets

£34.99

1
american-expressapple-paygoogle-paymasterpaypalvisaklarnatrustpilot