Your Basket

0 item(s)

shipping-icon

Free delivery on tests

trustpilotTrusted by 100,000+ clients
l-Tyrosine is a convenient and easy way to obtain the amino acid tyrosine in a vegetarian capsule. Tyrosine is an amino acid precursor to various proteins. Each vegetarian capsule provides 500mg of tyrosine.
Pure Encapsulations
See full range

l-Tyrosine 90s

l-Tyrosine is a convenient and easy way to obtain the amino acid tyrosine in a vegetarian capsule. Tyrosine is an amino acid precursor to various proteins. Each vegetarian capsule provides 500mg of tyrosine.

90 Capsules

£34.75

1
american-expressapple-paygoogle-paymasterpaypalvisaklarnatrustpilot