Your Basket

0 item(s)

shipping-icon

Free delivery on tests

trustpilotTrusted by 100,000+ clients
l-Carnitine provides high quality l-Carnitine as a highly bioavailable free-form amino acid. l-Carnitineis an amino acid found abundantly in skeletal and heart muscle and acts as a carrier of fatty acids into the mitochondria. Each vegetarian capsule provides 340 mg.
Pure Encapsulations
See full range

l-Carnitine 60s

l-Carnitine provides high quality l-Carnitine as a highly bioavailable free-form amino acid. l-Carnitineis an amino acid found abundantly in skeletal and heart muscle and acts as a carrier of fatty acids into the mitochondria. Each vegetarian capsule provides 340 mg.

60 Capsules

£53.85

1
american-expressapple-paygoogle-paymasterpaypalvisaklarnatrustpilot