Your Basket

0 item(s)

shipping-icon

Free delivery on tests

trustpilotTrusted by 100,000+ clients
L-Arginine is a clinically useful amino acid for enhancing heart health, the circulatory system and the immune system. It is a precursor of nitric oxide, known to be important for blood pressure maintenance and healthy endothelial function.
Designs For Health
See full range

L-Arginine 120's

L-Arginine is a clinically useful amino acid for enhancing heart health, the circulatory system and the immune system. It is a precursor of nitric oxide, known to be important for blood pressure maintenance and healthy endothelial function.

120 Capsules

£49.95

1
american-expressapple-paygoogle-paymasterpaypalvisaklarnatrustpilot