Your Basket

0 item(s)

shipping-icon

Free delivery on tests

trustpilotTrusted by 100,000+ clients
Supplies a supplemental source of immunoglobulin G from bovine colostrum, fortified with the amino acids L-Lysine and L-Arginine.
Biotics Research
See full range

Immuno-gG 100's

Supplies a supplemental source of immunoglobulin G from bovine colostrum, fortified with the amino acids L-Lysine and L-Arginine.

100 Capsules

£38.62

1
american-expressapple-paygoogle-paymasterpaypalvisaklarnatrustpilot