Your Basket

0 item(s)

shipping-icon

Free delivery on tests

trustpilotTrusted by 100,000+ clients
Strawberry flavour plant based drink mix for hair, skin, nails and collagen support. Glow up with Glowing All Over, carefully formulated to support healthy hair, skin and nails.

Glowing All Over Plant Protein Plus 250g

Strawberry flavour plant based drink mix for hair, skin, nails and collagen support. Glow up with Glowing All Over, carefully formulated to support healthy hair, skin and nails.

Powder / Granules 250 g

£35.00

1
american-expressapple-paygoogle-paymasterpaypalvisaklarnatrustpilot