Your Basket

0 item(s)

shipping-icon

Free delivery on tests

trustpilotTrusted by 100,000+ clients
Contains the scientifically supported formula ProDigest® to support digestive function and healthy gastric emptying and motility. ProDigest® benefits are further boosted with the power of Apple Cider with the "Mother".
Enzyme Science
See full range

GI Motility Complex 60's

Contains the scientifically supported formula ProDigest® to support digestive function and healthy gastric emptying and motility. ProDigest® benefits are further boosted with the power of Apple Cider with the "Mother".

60 Capsules

£57.14

1
american-expressapple-paygoogle-paymasterpaypalvisaklarnatrustpilot