Your Basket

0 item(s)

shipping-icon

Free delivery on tests

trustpilotTrusted by 100,000+ clients
Digestive Enzymes Ultra with Betaine HCl contains a high-strength, broad-spectrum mixture of vegetarian digestive enzymes with Betaine HCl. This comprehensive formula provides enzymes that are involved in the digestion of protein, carbohydrate, fat, fiber and lactose.
Pure Encapsulations
See full range

Digestive Enzymes Ultra with Betaine HCl 90s

Digestive Enzymes Ultra with Betaine HCl contains a high-strength, broad-spectrum mixture of vegetarian digestive enzymes with Betaine HCl. This comprehensive formula provides enzymes that are involved in the digestion of protein, carbohydrate, fat, fiber and lactose.

90 Capsules

£39.95

1
american-expressapple-paygoogle-paymasterpaypalvisaklarnatrustpilot