Your Basket

0 item(s)

shipping-icon

Free delivery on tests

trustpilotTrusted by 100,000+ clients
Organic plant-based solution, tailored to support collagen production and beauty from inside out. 100% vegan protein and peptides, combined with natural vitamin C, greens, tremella mushroom, silica, biotin and more, for skin, hair, joint and nail support. Gluten-free, Keto.
Sunwarrior
See full range

Collagen Building Protein Peptides Chocolate Fudge 500g

Organic plant-based solution, tailored to support collagen production and beauty from inside out. 100% vegan protein and peptides, combined with natural vitamin C, greens, tremella mushroom, silica, biotin and more, for skin, hair, joint and nail support. Gluten-free, Keto.

Powder / Granules 500 g

£41.99

1
american-expressapple-paygoogle-paymasterpaypalvisaklarnatrustpilot