Your Basket

0 item(s)

shipping-icon

Free delivery on tests

trustpilotTrusted by 100,000+ clients
All natural, patented, water-extracted, European golden pea protein isolate with all 9 essential amino acids. No dairy, gluten, soya, GMOs, lectins. FODMAP, Paleo, Vegan, Halal and Kosher friendly. Keto compatible. Easily assimilated by even the most vulnerable gut.

Clean Lean Protein Rich Chocolate 250g

All natural, patented, water-extracted, European golden pea protein isolate with all 9 essential amino acids. No dairy, gluten, soya, GMOs, lectins. FODMAP, Paleo, Vegan, Halal and Kosher friendly. Keto compatible. Easily assimilated by even the most vulnerable gut.

Powder / Granules 250 g

£21.99

1
american-expressapple-paygoogle-paymasterpaypalvisaklarnatrustpilot