Your Basket

0 item(s)

shipping-icon

Free delivery on tests

trustpilotTrusted by 100,000+ clients
Boosts hydration, has a plumping effect, regulates skin microbiome, improves skin barrier, prevents premature skin ageing. Contains hyaluronic acid, vitamin D agonist (boosts the production of vitamin D receptor proteins), beneficial bacteria and magnesium. For all skin types. 99.8% natural.
Skin Diligent
See full range

Cellular Hydration Serum 30ml

Boosts hydration, has a plumping effect, regulates skin microbiome, improves skin barrier, prevents premature skin ageing. Contains hyaluronic acid, vitamin D agonist (boosts the production of vitamin D receptor proteins), beneficial bacteria and magnesium. For all skin types. 99.8% natural.

Serum 30 ml

£49.00

1
american-expressapple-paygoogle-paymasterpaypalvisaklarnatrustpilot