Your Basket

0 item(s)

shipping-icon

Free delivery on tests

trustpilotTrusted by 100,000+ clients
Use Bromelain Plus CLA when the need for extra digestive support has been determined. If taken with food, it will act as a digestive aid. If taken on an empty stomach, it will function as a proteolytic enzyme.
Biotics Research
See full range

Bromelain Plus CLA 100's

Use Bromelain Plus CLA when the need for extra digestive support has been determined. If taken with food, it will act as a digestive aid. If taken on an empty stomach, it will function as a proteolytic enzyme.

100 Tablets

£26.77

1
american-expressapple-paygoogle-paymasterpaypalvisaklarnatrustpilot